Amyloid-beta 40 type 1 filament from the leptomeninges of individual with alzheimer's disease and cerebral amyloid angiopathy
PDB DOI: 10.2210/pdb8qn7/pdb
Classification: PROTEIN FIBRIL Organism(s): Salmonella Enterica
Deposited: 2023-09-25 Deposition Author(s): Franco, C. , Ghetti, B. , Goedert, M. , Murzin, A.S. , Newell, K.L. , Peak-Chew, S.Y. , Scheres, S.H.W. , Yang, Y.
Amyloid-beta 40 type 1 filament from the leptomeninges of individual with alzheimer's disease and cerebral amyloid angiopathy
Franco, C. , Ghetti, B. , Goedert, M. , Murzin, A.S. , Newell, K.L. , Peak-Chew, S.Y. , Scheres, S.H.W. , Yang, Y.
Primary Citation of Related Structures: 8QN7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Amyloid-beta A4 protein | A | 40 | Salmonella Enterica | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Method: ELECTRON MICROSCOPY
Deposited Date: 2023-09-25 Deposition Author(s): Franco, C. , Ghetti, B. , Goedert, M. , Murzin, A.S. , Newell, K.L. , Peak-Chew, S.Y. , Scheres, S.H.W. , Yang, Y.