Crphotlov1 light state structure 22.5 ms (20-25 ms) after illumination determined by time-resolved serial synchrotron crystallography at room temperature
PDB DOI: 10.2210/pdb8qih/pdb
Classification: FLAVOPROTEIN Organism(s): Chlamydomonas Reinhardtii
Deposited: 2023-09-12 Deposition Author(s): Antonia, F. , Dworkowski, F. , Gashi, D. , Gotthard, G. , Heberle, J. , James, D. , Maia, R.N.A. , Mous, S. , Nogly, P. , Ozerov, D. , Panepucci, E. , Schertler, G.F.X. , Standfuss, J. , Wang, M. , Weinert, T.
Method: X-RAY DIFFRACTION Resolution: 2.5 Å
Crphotlov1 light state structure 22.5 ms (20-25 ms) after illumination determined by time-resolved serial synchrotron crystallography at room temperature
Antonia, F. , Dworkowski, F. , Gashi, D. , Gotthard, G. , Heberle, J. , James, D. , Maia, R.N.A. , Mous, S. , Nogly, P. , Ozerov, D. , Panepucci, E. , Schertler, G.F.X. , Standfuss, J. , Wang, M. , Weinert, T.
Primary Citation of Related Structures: 8QIH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phototropin | A | 138 | Chlamydomonas Reinhardtii | HHHHHHHHHHSSGHIEGRHMAGLRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDAIKKGEACSVRLLNYRKDGTPFWNLLTVTPIKTPDGRVSKFVGVQVDVTSKTEGKALA |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-09-12 Deposition Author(s): Antonia, F. , Dworkowski, F. , Gashi, D. , Gotthard, G. , Heberle, J. , James, D. , Maia, R.N.A. , Mous, S. , Nogly, P. , Ozerov, D. , Panepucci, E. , Schertler, G.F.X. , Standfuss, J. , Wang, M. , Weinert, T.