18mer dna mimic foldamer with an aliphatic linker in complex with sac7d v26a/m29a protein
PDB DOI: 10.2210/pdb8q2m/pdb
Classification: DNA BINDING PROTEIN Organism(s): Sulfolobus Acidocaldarius , Synthetic Construct
Deposited: 2023-08-02 Deposition Author(s): Corvaglia, V. , Deepak, D. , Huc, I. , Wu, J.
Method: X-RAY DIFFRACTION Resolution: 3.21 Å
18mer dna mimic foldamer with an aliphatic linker in complex with sac7d v26a/m29a protein
Corvaglia, V. , Deepak, D. , Huc, I. , Wu, J.
Primary Citation of Related Structures: 8Q2M
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA-binding protein 7b | AA | 66 | Sulfolobus Acidocaldarius , Synthetic Construct | MVKVKFKYKGEEKEVDTSKIKKVWRAGKAVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK |
| DNA mimic Foldamer | A | 10 | Sulfolobus Acidocaldarius , Synthetic Construct | XXXXXXXXXX |
| DNA mimic Foldamer | B | 10 | Sulfolobus Acidocaldarius , Synthetic Construct | XXXXXXXXXX |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-08-02 Deposition Author(s): Corvaglia, V. , Deepak, D. , Huc, I. , Wu, J.