Structure of the ww domain tandem of prpf40a
PDB DOI: 10.2210/pdb8pxw/pdb
Classification: SPLICING Organism(s): Homo Sapiens
Deposited: 2023-07-24 Deposition Author(s): Martinez-Lumbreras, S. , Sattler, M.
Structure of the ww domain tandem of prpf40a
Martinez-Lumbreras, S. , Sattler, M.
Primary Citation of Related Structures: 8PXW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Pre-mRNA-processing factor 40 homolog A | A | 99 | Homo Sapiens | GAMGAKSMWTEHKSPDGRTYYYNTETKQSTWEKPDDLKTPAEQLLSKCPWKEYKSDSGKPYYYNSQTKESRWAKPKELEDLEGYQNTIVAGSLITKSNL |
Method: SOLUTION NMR
Deposited Date: 2023-07-24 Deposition Author(s): Martinez-Lumbreras, S. , Sattler, M.