Solution structure of the peptide u11-myrtx-tb1a from the venom of the ant tetramorium bicarinatum
PDB DOI: 10.2210/pdb8pwt/pdb
Classification: TOXIN Organism(s): N.A.
Deposited: 2023-07-21 Deposition Author(s): Jouvensal, L. , Loth, K. , Paquet, F.
Solution structure of the peptide u11-myrtx-tb1a from the venom of the ant tetramorium bicarinatum
Jouvensal, L. , Loth, K. , Paquet, F.
Primary Citation of Related Structures: 8PWT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| U11-myrmicitoxin-Tb1a | A | 34 | N.A. | GKEKEKLKQCFKDMTLAAIDYAKHKVEKHLFKCI |
Method: SOLUTION NMR
Deposited Date: 2023-07-21 Deposition Author(s): Jouvensal, L. , Loth, K. , Paquet, F.