Structure of immature htlv-1 ca-ntd from in vitro assembled ma126-canc tubes: axis angle -15 degrees
PDB DOI: 10.2210/pdb8pu8/pdb
Classification: VIRAL PROTEIN Organism(s): Human T-Cell Leukemia Virus Type I
Deposited: 2023-07-17 Deposition Author(s): Chernikova, D. , Dick, R.A. , Mansky, L.M. , Obr, M. , Percipalle, M. , Pinke, G. , Porley, D. , Schur, F.K.M. , Thader, A. , Yang, H.
Structure of immature htlv-1 ca-ntd from in vitro assembled ma126-canc tubes: axis angle -15 degrees
Chernikova, D. , Dick, R.A. , Mansky, L.M. , Obr, M. , Percipalle, M. , Pinke, G. , Porley, D. , Schur, F.K.M. , Thader, A. , Yang, H.
Primary Citation of Related Structures: 8PU8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Gag protein (Fragment) | A | 125 | Human T-Cell Leukemia Virus Type I | PVMHPHGAPPNHRPWQMKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQYLCSSLVASLHHQQLDSLISEAETRGITGYNPLAGPLRVQANNPQQQGLRREYQQLWLAAFAALP |
| Gag protein (Fragment) | B | 125 | Human T-Cell Leukemia Virus Type I | PVMHPHGAPPNHRPWQMKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQYLCSSLVASLHHQQLDSLISEAETRGITGYNPLAGPLRVQANNPQQQGLRREYQQLWLAAFAALP |
| Gag protein (Fragment) | C | 125 | Human T-Cell Leukemia Virus Type I | PVMHPHGAPPNHRPWQMKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQYLCSSLVASLHHQQLDSLISEAETRGITGYNPLAGPLRVQANNPQQQGLRREYQQLWLAAFAALP |
Method: ELECTRON MICROSCOPY
Deposited Date: 2023-07-17 Deposition Author(s): Chernikova, D. , Dick, R.A. , Mansky, L.M. , Obr, M. , Percipalle, M. , Pinke, G. , Porley, D. , Schur, F.K.M. , Thader, A. , Yang, H.