The structure of nvbagel2 in the presence of cu(ii)
PDB DOI: 10.2210/pdb8prq/pdb
Classification: BIOSYNTHETIC PROTEIN Organism(s): Dictyoglomus Thermophilum (Strain Atcc 35947 / Dsm 3960 / H-6-12)
Deposited: 2023-07-12 Deposition Author(s): Lee, X.Y. , Vandebroek, L. , Voet, A.R.D.
Method: X-RAY DIFFRACTION Resolution: 1.46 Å
The structure of nvbagel2 in the presence of cu(ii)
Lee, X.Y. , Vandebroek, L. , Voet, A.R.D.
Primary Citation of Related Structures: 8PRQ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Cell surface protein | A | 84 | Dictyoglomus Thermophilum (Strain Atcc 35947 / Dsm 3960 / H-6-12) | GSHMTGGSVHSSPAIGQDGTIYVGSNDHYLYAINPNGKLKWKFETGGSVHSSPAIGQDGTIYVGSNDHYLYAINPNGKLKWKFE |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-07-12 Deposition Author(s): Lee, X.Y. , Vandebroek, L. , Voet, A.R.D.