Sak single strand annealing protein from staphylococcal bacteriophage 80a - dctd
PDB DOI: 10.2210/pdb8pq8/pdb
Classification: RECOMBINATION Organism(s): Staphylococcus Phage 80Alpha
Deposited: 2023-07-10 Deposition Author(s): Debiasi-Anders, G. , Mir-Sanchis, I.
Sak single strand annealing protein from staphylococcal bacteriophage 80a - dctd
Debiasi-Anders, G. , Mir-Sanchis, I.
Primary Citation of Related Structures: 8PQ8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Topoisomerase | A | 169 | Staphylococcus Phage 80Alpha | MKHHHHHHPMSDYDIPTTENLYFQGAMGMTEQTLFEQLNSKNVNDHTEQKNGLTYLAWSYAHQELKKIDPNYTVKVHEFPHPDINTENYFVPYLATPEGYFVQVSVTVKDSTETEWLPVLDFRNKSLAKGSATTFDINKAQKRCFVKASALHGLGLYIYNGEELPSASD |
Method: ELECTRON MICROSCOPY
Deposited Date: 2023-07-10 Deposition Author(s): Debiasi-Anders, G. , Mir-Sanchis, I.