8P66
Structural basis of aggregate binding/recognition by the aaa+ disaggregase clpg
PDB DOI: 10.2210/pdb8p66/pdb
Classification: CHAPERONE Organism(s): Pseudomonas Aeruginosa
Deposited: 2023-05-25 Deposition Author(s): Hennig, J. , Mogk, A. , Simon, B.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structural basis of aggregate binding/recognition by the aaa+ disaggregase clpg
Hennig, J. , Mogk, A. , Simon, B.
Primary Citation of Related Structures: 8P66
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Clp protease ClpC,Heat shock survival AAA family ATPase ClpK | B | 54 | Pseudomonas Aeruginosa | MARKQCQVCGQPATVRVEANLNGRHSTMLLCDDHYRQLVRQQKRTVWSHPQFEK |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2023-05-25 Deposition Author(s): Hennig, J. , Mogk, A. , Simon, B.