8OPI
Vhh z70 mutant 1 in interaction with phf6 tau peptide
PDB DOI: 10.2210/pdb8opi/pdb
Classification: IMMUNE SYSTEM Organism(s): Klebsiella Phage Phiko2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2023-04-07 Deposition Author(s): Dupre, E. , Hanoulle, X. , Landrieu, I. , Mortelecque, J. , Nguyen, M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.83 Å
Vhh z70 mutant 1 in interaction with phf6 tau peptide
Dupre, E. , Hanoulle, X. , Landrieu, I. , Mortelecque, J. , Nguyen, M.
Primary Citation of Related Structures: 8OPI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| VHH Z70 mutant 1 | A | 129 | Klebsiella Phage Phiko2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAMAEVQLQASGGVFVQSGGSLRLSCAASGATSTFDGMGWFRQAPGKEREFVSAISYEQGSYTYYADSVKGRFTISRDNSKNMVYLQMNSLRAEDTATYYCAPAYEGDLYAFDSYGEQGTQVTVSSAAA |
| PHF6 Tau peptide | B | 14 | Klebsiella Phage Phiko2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PGGGSVQIVYKPKK |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2023-04-07 Deposition Author(s): Dupre, E. , Hanoulle, X. , Landrieu, I. , Mortelecque, J. , Nguyen, M.