Crystal structure of c/ebpbeta bzip domain bound to a high affinity dna
PDB DOI: 10.2210/pdb8k8d/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2023-07-29 Deposition Author(s): Chen, S.Z. , Liu, K. , Min, J.R.
Crystal structure of c/ebpbeta bzip domain bound to a high affinity dna
Chen, S.Z. , Liu, K. , Min, J.R.
Primary Citation of Related Structures: 8K8D
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
CCAAT/enhancer-binding protein beta | A | 79 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPE |
CCAAT/enhancer-binding protein beta | B | 79 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPE |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-07-29 Deposition Author(s): Chen, S.Z. , Liu, K. , Min, J.R.