Crystal structure of nfil3 in complex with ttatgtaa dna
PDB DOI: 10.2210/pdb8k86/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2023-07-28 Deposition Author(s): Chen, S.Z. , Liu, K. , Min, J.R.
Crystal structure of nfil3 in complex with ttatgtaa dna
Chen, S.Z. , Liu, K. , Min, J.R.
Primary Citation of Related Structures: 8K86
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Nuclear factor interleukin-3-regulated protein | A | 73 | Homo Sapiens , Synthetic Construct | GEFMPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLSLKLKFGLISSTAYAQ |
| Nuclear factor interleukin-3-regulated protein | B | 73 | Homo Sapiens , Synthetic Construct | GEFMPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLSLKLKFGLISSTAYAQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-07-28 Deposition Author(s): Chen, S.Z. , Liu, K. , Min, J.R.