8K81
Solution nmr structure of zf3 (fragment 346-396) from human insulinoma-associated protein 1(insm1)
PDB DOI: 10.2210/pdb8k81/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2023-07-28 Deposition Author(s): He, X.L. , Yang, Y.H.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of zf3 (fragment 346-396) from human insulinoma-associated protein 1(insm1)
Primary Citation of Related Structures: 8K81
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulinoma-associated protein 1 | A | 51 | Homo Sapiens | GSDRDTPSPGGVSESGSEDGLYECHHCAKKFRRQAYLRKHLLAHHQALQAK |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2023-07-28 Deposition Author(s): He, X.L. , Yang, Y.H.