Solution nmr structure of purs subunit of phosphoribosylformylglycinamidine synthase enzyme from staphylococcus aureus
PDB DOI: 10.2210/pdb8j3n/pdb
Classification: LYASE Organism(s): Staphylococcus Aureus Subsp. Aureus Mu50
Deposited: 2023-04-17 Deposition Author(s): Ashraf, F. , Choudhary, M.I. , Wahab, A.
Solution nmr structure of purs subunit of phosphoribosylformylglycinamidine synthase enzyme from staphylococcus aureus
Ashraf, F. , Choudhary, M.I. , Wahab, A.
Primary Citation of Related Structures: 8J3N
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phosphoribosylformylglycinamidine synthase subunit PurS | A | 89 | Staphylococcus Aureus Subsp. Aureus Mu50 | AGMKTIELHITLQPQVLDTQGQTLTRAVHDLGYAQVNDIRVGKVLYMTVDEVSDEKVHNIITTLSEKLFANTVIEEYSYKVLDDEKENA |
Method: SOLUTION NMR
Deposited Date: 2023-04-17 Deposition Author(s): Ashraf, F. , Choudhary, M.I. , Wahab, A.