Solution structure of the n terminal domain of maze9 antitoxin (nmaze9) from mycobacterium tuberculosis
PDB DOI: 10.2210/pdb8imh/pdb
Classification: ANTITOXIN Organism(s): Desulfobacula Toluolica
Deposited: 2023-03-06 Deposition Author(s): Basu Roy, T. , Sarma, S.P.
Solution structure of the n terminal domain of maze9 antitoxin (nmaze9) from mycobacterium tuberculosis
Primary Citation of Related Structures: 8IMH
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Antitoxin MazE9 | A | 43 | Desulfobacula Toluolica | SGSMKLSVSLSDDDVAILDAYVKRAGLPSRSAGLQHAIRVLRY |
Antitoxin MazE9 | B | 43 | Desulfobacula Toluolica | SGSMKLSVSLSDDDVAILDAYVKRAGLPSRSAGLQHAIRVLRY |
Method: SOLUTION NMR
Deposited Date: 2023-03-06 Deposition Author(s): Basu Roy, T. , Sarma, S.P.