Solution structure of the mouse hoil1-l nzf domain in the free form
PDB DOI: 10.2210/pdb8im5/pdb
Classification: IMMUNE SYSTEM Organism(s): Mus Musculus
Deposited: 2023-03-06 Deposition Author(s): Morimoto, D. , Walinda, E.
Solution structure of the mouse hoil1-l nzf domain in the free form
Primary Citation of Related Structures: 8IM5
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
RanBP-type and C3HC4-type zinc finger-containing protein 1 | A | 66 | Mus Musculus | GPLGSPEPVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDEEERARLAGEEEALRQYQQ |
Method: SOLUTION NMR
Deposited Date: 2023-03-06 Deposition Author(s): Morimoto, D. , Walinda, E.