PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

8IA5

Small peptide enhances the binding of nutline-3a to n-terminal domain of mdmx

PDB DOI: 10.2210/pdb8ia5/pdb

Classification: ONCOPROTEIN
Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2023-02-07
Deposition Author(s): Cheng, X.Y. , Huang, Y. , Su, Z.D. , Wei, Q.Y.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.93 Å

Literature

Small peptide enhances the binding of nutline-3a to n-terminal domain of mdmx

Cheng, X.Y. , Huang, Y. , Su, Z.D. , Wei, Q.Y.

Primary Citation of Related Structures: 8IA5


Proteins
Molecule Chains Sequence Length Organism Sequence
Protein Mdm4 A 90 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) SQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLAT
9-mer peptide B 9 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) DLENLYFQG
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2023-02-07
Deposition Author(s): Cheng, X.Y. , Huang, Y. , Su, Z.D. , Wei, Q.Y.