Crystal structure of cas2 in complex with acrva5-peptide
PDB DOI: 10.2210/pdb8ia4/pdb
Classification: GENE REGULATION Organism(s): Treponema Denticola (Strain Atcc 35405 / Dsm 14222 / Cip 103919 / Jcm 8153 / Kctc 15104) , Synthetic Construct
Deposited: 2023-02-07 Deposition Author(s): Mo, X.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
CRISPR-associated endoribonuclease Cas2 | A | 101 | Treponema Denticola (Strain Atcc 35405 / Dsm 14222 / Cip 103919 / Jcm 8153 / Kctc 15104) , Synthetic Construct | MRVIVFFDLPVITPENRHNYSVFRKYLIKSGFIMQQKSVYSKLVLNLTNRDSIVKSIEKNKPPEGLVEVLTVTEKQYAKMEIIIGESKTEYLNTDERLVVL |
CRISPR-associated endoribonuclease Cas2 | B | 101 | Treponema Denticola (Strain Atcc 35405 / Dsm 14222 / Cip 103919 / Jcm 8153 / Kctc 15104) , Synthetic Construct | MRVIVFFDLPVITPENRHNYSVFRKYLIKSGFIMQQKSVYSKLVLNLTNRDSIVKSIEKNKPPEGLVEVLTVTEKQYAKMEIIIGESKTEYLNTDERLVVL |
peptide | Q | 5 | Treponema Denticola (Strain Atcc 35405 / Dsm 14222 / Cip 103919 / Jcm 8153 / Kctc 15104) , Synthetic Construct | IELSG |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-02-07 Deposition Author(s): Mo, X.