Crystal structure of mycobacterium tuberculosis uracil-dna glycosylase in complex with barbituric acid and citric acid, form i
PDB DOI: 10.2210/pdb8i61/pdb
Classification: HYDROLASE Organism(s): Mycobacterium Tuberculosis H37Rv
Deposited: 2023-01-27 Deposition Author(s): Gopal, B. , Paul, A. , Raj, P.
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Uracil-DNA glycosylase | A | 238 | Mycobacterium Tuberculosis H37Rv | MHHHHHHGMASMTARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP |
Method: X-RAY DIFFRACTION