8I60
Crystal structure of gas41 yeats domain in complex with histone h3k27cr
PDB DOI: 10.2210/pdb8i60/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2023-01-26 Deposition Author(s): Konuma, T. , Zhou, M.-M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.3 Å
Crystal structure of gas41 yeats domain in complex with histone h3k27cr
Primary Citation of Related Structures: 8I60
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| YEATS domain-containing protein 4 | C | 142 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAM |
| YEATS domain-containing protein 4 | D | 142 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAM |
| ALA-ARG-KCR-SER-ALA-PRO | A | 13 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ATKAARXSAPATG |
| ALA-ARG-KCR-SER-ALA-PRO | B | 13 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ATKAARXSAPATG |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2023-01-26 Deposition Author(s): Konuma, T. , Zhou, M.-M.