Advanced Search:
8H02
Crystal structure of synechococcus elongatus pcc 7942 rna polymerase si3-tail
PDB DOI: 10.2210/pdb8h02/pdb
Classification: TRANSCRIPTION Organism(s): Synechococcus Elongatus (Strain Pcc 7942 / Fachb-805)
Deposited: 2022-09-27 Deposition Author(s): Shen, L.Q. , Zhang, Y.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.552 Å
Crystal structure of synechococcus elongatus pcc 7942 rna polymerase si3-tail
Primary Citation of Related Structures: 8H02
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA-directed RNA polymerase subunit beta' | A | 84 | Synechococcus Elongatus (Strain Pcc 7942 / Fachb-805) | GETARLLRAPVAGTIKLGKKARTRPYRTRHGEEALLAEANFDLVLEGKGRKETFAILQGSTIFVQDGDKVAAEAILAEVPVSGR |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2022-09-27 Deposition Author(s): Shen, L.Q. , Zhang, Y.