The crystal structure of zbtb10 zf1-2 r767q in complex with telomeric dna ttaggg
PDB DOI: 10.2210/pdb8gn4/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2022-08-22 Deposition Author(s): Li, F.D. , Wang, S.M.
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
The crystal structure of zbtb10 zf1-2 r767q in complex with telomeric dna ttaggg
Primary Citation of Related Structures: 8GN4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Zinc finger and BTB domain-containing protein 10 | A | 67 | Homo Sapiens , Synthetic Construct | GESSLIMNKLKCPHCSYVAKYRRTLKRHLLIHTGVRSFSCDICGKLFTRREHVKQHSLVHKKDKKYK |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-08-22 Deposition Author(s): Li, F.D. , Wang, S.M.