Structure of hdac6 zinc-finger ubiquitin binding domain in complex with 3-(3-(2-(benzylamino)-2-oxoethyl)-4-oxo-3,4-dihydroquinazolin-2-yl)propanoic acid
PDB DOI: 10.2210/pdb8g44/pdb
Classification: HYDROLASE/INHIBITOR Organism(s): Homo Sapiens
Deposited: 2023-02-08 Deposition Author(s): Ackloo, S. , Arrowsmith, C.H. , Baker, R.J. , Barsyte-Lovejoy, D. , Brown, P.J. , Dank, C. , Franzoni, I. , Harding, R.J. , Juarez-Ornelas, K.A. , Lautens, M. , Mann, M.K. , Mirabi, B. , Owens, D.D.G. , Sanichar, R. , Santhakumar, V. , Schapira, M. , Scheremetjew, A. , Structural Genomics Consortium (Sgc) , Szewczyk, M.
Method: X-RAY DIFFRACTION Resolution: 1.55 Å
Structure of hdac6 zinc-finger ubiquitin binding domain in complex with 3-(3-(2-(benzylamino)-2-oxoethyl)-4-oxo-3,4-dihydroquinazolin-2-yl)propanoic acid
Ackloo, S. , Arrowsmith, C.H. , Baker, R.J. , Barsyte-Lovejoy, D. , Brown, P.J. , Dank, C. , Franzoni, I. , Harding, R.J. , Juarez-Ornelas, K.A. , Lautens, M. , Mann, M.K. , Mirabi, B. , Owens, D.D.G. , Sanichar, R. , Santhakumar, V. , Schapira, M. , Scheremetjew, A. , Structural Genomics Consortium (Sgc) , Szewczyk, M.
Primary Citation of Related Structures: 8G44
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Histone deacetylase 6 | A | 107 | Homo Sapiens | GSPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPH |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-02-08 Deposition Author(s): Ackloo, S. , Arrowsmith, C.H. , Baker, R.J. , Barsyte-Lovejoy, D. , Brown, P.J. , Dank, C. , Franzoni, I. , Harding, R.J. , Juarez-Ornelas, K.A. , Lautens, M. , Mann, M.K. , Mirabi, B. , Owens, D.D.G. , Sanichar, R. , Santhakumar, V. , Schapira, M. , Scheremetjew, A. , Structural Genomics Consortium (Sgc) , Szewczyk, M.