Crystal structure of the human chip-tpr domain in complex with a 10mer acetylated tau peptide
PDB DOI: 10.2210/pdb8fyu/pdb
Classification: LIGASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2023-01-26 Deposition Author(s): Basu, K. , Bohn, M.F. , Craik, C.S. , Gestwicki, J.E. , Nadel, C.M. , Wucherer, K.
Method: X-RAY DIFFRACTION Resolution: 1.84839 Å
Crystal structure of the human chip-tpr domain in complex with a 10mer acetylated tau peptide
Basu, K. , Bohn, M.F. , Craik, C.S. , Gestwicki, J.E. , Nadel, C.M. , Wucherer, K.
Primary Citation of Related Structures: 8FYU
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase CHIP | B | 128 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNS |
E3 ubiquitin-protein ligase CHIP | A | 128 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNS |
ACE-SER-SER-THR-GLY-SER-ILE-ASP-MET-VAL-ASP | E | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SSTGSIDMVD |
ACE-SER-SER-THR-GLY-SER-ILE-ASP-MET-VAL-ASP | C | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SSTGSIDMVD |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-01-26 Deposition Author(s): Basu, K. , Bohn, M.F. , Craik, C.S. , Gestwicki, J.E. , Nadel, C.M. , Wucherer, K.