Solution structure of mu-theraphotoxin cg4a from chinese tarantula chilobrachys jingzhao
PDB DOI: 10.2210/pdb8fd4/pdb
Classification: TOXIN Organism(s): Chilobrachys Guangxiensis
Deposited: 2022-12-01 Deposition Author(s): Chin, Y.K.Y. , Jia, X. , Mobli, M. , Sharma, G.
Solution structure of mu-theraphotoxin cg4a from chinese tarantula chilobrachys jingzhao
Chin, Y.K.Y. , Jia, X. , Mobli, M. , Sharma, G.
Primary Citation of Related Structures: 8FD4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Jingzhaotoxin F7-10.36 | A | 34 | Chilobrachys Guangxiensis | SCKVPFNECKYGADECCKGYVCSKRDGWCKYHIN |
Method: SOLUTION NMR
Deposited Date: 2022-12-01 Deposition Author(s): Chin, Y.K.Y. , Jia, X. , Mobli, M. , Sharma, G.