Structure of a 60mer degp cage bound to the client protein htrf1
PDB DOI: 10.2210/pdb8f26/pdb
Classification: CHAPERONE, HYDROLASE Organism(s): Helicobacter Pylori Bacteriophage Khp30 , Salmonella Enterica
Deposited: 2022-11-07 Deposition Author(s): Di Trani, J.M. , Harkness, R.W. , Kay, L.E. , Ripstein, Z.A.
Structure of a 60mer degp cage bound to the client protein htrf1
Di Trani, J.M. , Harkness, R.W. , Kay, L.E. , Ripstein, Z.A.
Primary Citation of Related Structures: 8F26
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Telomeric repeat-binding factor 1 | A | 27 | Helicobacter Pylori Bacteriophage Khp30 , Salmonella Enterica | SKILLHYKFNNRTSVMLKDRWRTMKKL |
Periplasmic serine endoprotease DegP | D | 75 | Helicobacter Pylori Bacteriophage Khp30 , Salmonella Enterica | AEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ |
Method: ELECTRON MICROSCOPY
Deposited Date: 2022-11-07 Deposition Author(s): Di Trani, J.M. , Harkness, R.W. , Kay, L.E. , Ripstein, Z.A.