Crystal structure of the homeodomain of platypus sdux in complex with dna containing 5-bromouracil
PDB DOI: 10.2210/pdb8ejp/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Ornithorhynchus Anatinus , Synthetic Construct
Deposited: 2022-09-18 Deposition Author(s): Aihara, H. , Shi, K. , Yin, L.
Method: X-RAY DIFFRACTION Resolution: 2.174 Å
Crystal structure of the homeodomain of platypus sdux in complex with dna containing 5-bromouracil
Aihara, H. , Shi, K. , Yin, L.
Primary Citation of Related Structures: 8EJP
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Homeobox domain-containing protein | A | 71 | Ornithorhynchus Anatinus , Synthetic Construct | GPAREGARRKRTTFNKTQLEILVKSFNKDPYPGIGVREHLASLIQIPESRIQVWFQNRRARQLGQKKKLEV |
Homeobox domain-containing protein | B | 71 | Ornithorhynchus Anatinus , Synthetic Construct | GPAREGARRKRTTFNKTQLEILVKSFNKDPYPGIGVREHLASLIQIPESRIQVWFQNRRARQLGQKKKLEV |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-09-18 Deposition Author(s): Aihara, H. , Shi, K. , Yin, L.