Structure of the k39q mutant of rat somatic cytochrome c at 1.36a
PDB DOI: 10.2210/pdb8dzl/pdb
Classification: ELECTRON TRANSPORT Organism(s): Rattus Norvegicus
Deposited: 2022-08-08 Deposition Author(s): Brunzelle, J. , Edwards, B.F.P. , Huettemann, M. , Morse, P. , Vaishnav, A. , Wan, J.
Structure of the k39q mutant of rat somatic cytochrome c at 1.36a
Brunzelle, J. , Edwards, B.F.P. , Huettemann, M. , Morse, P. , Vaishnav, A. , Wan, J.
Primary Citation of Related Structures: 8DZL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cytochrome c, somatic | A | 104 | Rattus Norvegicus | GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRQTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE |
| Cytochrome c, somatic | B | 104 | Rattus Norvegicus | GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRQTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE |
| Cytochrome c, somatic | C | 104 | Rattus Norvegicus | GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRQTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE |
| Cytochrome c, somatic | D | 104 | Rattus Norvegicus | GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRQTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-08-08 Deposition Author(s): Brunzelle, J. , Edwards, B.F.P. , Huettemann, M. , Morse, P. , Vaishnav, A. , Wan, J.