8DDD
Intramembrane recognition between transmembrane domains of il-9r and common gamma chain
PDB DOI: 10.2210/pdb8ddd/pdb
Classification: MEMBRANE PROTEIN Organism(s): Mus Musculus
Deposited: 2022-06-17 Deposition Author(s): Cai, T. , Chou, J.J. , Lenoir Capello, R.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Intramembrane recognition between transmembrane domains of il-9r and common gamma chain
Cai, T. , Chou, J.J. , Lenoir Capello, R.
Primary Citation of Related Structures: 8DDD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cytokine receptor common subunit gamma | A | 34 | Mus Musculus | EENPSLFALEAVLIPVGTVGLIITLIFVYFWLER |
| Interleukin-9 receptor | B | 31 | Mus Musculus | QWSASILVVVPIFLLLTGFVHLLFKLSPRLK |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2022-06-17 Deposition Author(s): Cai, T. , Chou, J.J. , Lenoir Capello, R.