Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing beta-3-homotryptophan
PDB DOI: 10.2210/pdb8d51/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2022-06-03 Deposition Author(s): Gellman, S.H. , Kreitler, D.F. , Yu, Z.
Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing beta-3-homotryptophan
Gellman, S.H. , Kreitler, D.F. , Yu, Z.
Primary Citation of Related Structures: 8D51
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Parathyroid hormone/parathyroid hormone-related peptide receptor | A | 103 | Homo Sapiens , Synthetic Construct | GDDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPAGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFL |
| PTHrP[1-36] | B | 22 | Homo Sapiens , Synthetic Construct | IQDLRRRFFLHHLIAEWHTAEI |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-06-03 Deposition Author(s): Gellman, S.H. , Kreitler, D.F. , Yu, Z.