Whib3 bound to sigmaar4-rnap beta flap tip chimera and dna
PDB DOI: 10.2210/pdb8cyf/pdb
Classification: TRANSCRIPTION/DNA/Transferase Organism(s): Mycobacterium Tuberculosis , Synthetic Construct
Deposited: 2022-05-23 Deposition Author(s): Wan, T. , Zhang, L.M.
Method: X-RAY DIFFRACTION Resolution: 2.44 Å
Whib3 bound to sigmaar4-rnap beta flap tip chimera and dna
Primary Citation of Related Structures: 8CYF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Redox- and pH-responsive transcriptional regulator WhiB3 | A | 102 | Mycobacterium Tuberculosis , Synthetic Construct | MPQPEQLPGPNADIWNWQLQGLCRGMDSSMFFHPDGERGRARTQREQRAKEMCRRCPVIEACRSHALEVGEPYGVWGGLSESERDLLLKGTMGRTRGIRRTA |
| RNA polymerase sigma factor, DNA-directed RNA polymerase subunit beta chimera,DNA-directed RNA polymerase subunit beta | B | 112 | Mycobacterium Tuberculosis , Synthetic Construct | MAHHHHHHVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLDGSSGSGTPEERLLRAIFGEKA |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-05-23 Deposition Author(s): Wan, T. , Zhang, L.M.