Structure of a k+ selective nak mutant (nak2k, laue diffraction) in the presence of an electric field of ~0.8mv/cm along the crystallographic z axis, 1us, with eightfold extrapolation of structure factor differences
PDB DOI: 10.2210/pdb8cu4/pdb
Classification: MEMBRANE PROTEIN Organism(s): Vibrio Cholerae Serotype O1 (Strain Atcc 39541 / Classical Ogawa 395 / O395)
Deposited: 2022-05-16 Deposition Author(s): Hekstra, D. , Henning, R. , Klureza, M.A. , Lee, B. , Ranganathan, R. , Socolich, M.A. , Srajer, V. , White, K.I.
Structure of a k+ selective nak mutant (nak2k, laue diffraction) in the presence of an electric field of ~0.8mv/cm along the crystallographic z axis, 1us, with eightfold extrapolation of structure factor differences
Hekstra, D. , Henning, R. , Klureza, M.A. , Lee, B. , Ranganathan, R. , Socolich, M.A. , Srajer, V. , White, K.I.
Primary Citation of Related Structures: 8CU4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Potassium channel protein | A | 96 | Vibrio Cholerae Serotype O1 (Strain Atcc 39541 / Classical Ogawa 395 / O395) | AKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVPR |
Potassium channel protein | B | 96 | Vibrio Cholerae Serotype O1 (Strain Atcc 39541 / Classical Ogawa 395 / O395) | AKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVPR |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-05-16 Deposition Author(s): Hekstra, D. , Henning, R. , Klureza, M.A. , Lee, B. , Ranganathan, R. , Socolich, M.A. , Srajer, V. , White, K.I.