8CN3
Hdlg1-pdz2 in complex with a tax1 peptide from htlv-1
PDB DOI: 10.2210/pdb8cn3/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2023-02-21 Deposition Author(s): Maseko, S. , Remaut, H. , Sogues, A. , Twizere, J.C. , Volkov, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.71 Å
Hdlg1-pdz2 in complex with a tax1 peptide from htlv-1
Maseko, S. , Remaut, H. , Sogues, A. , Twizere, J.C. , Volkov, A.
Primary Citation of Related Structures: 8CN3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Disks large homolog 1 | A | 117 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNS |
| Disks large homolog 1 | B | 117 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSKPVSEMIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNS |
| GLU-THR-GLU-VAL | C | 4 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ETEV |
| GLU-THR-GLU-VAL | D | 4 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ETEV |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2023-02-21 Deposition Author(s): Maseko, S. , Remaut, H. , Sogues, A. , Twizere, J.C. , Volkov, A.