Sh3 domain solved by the exact solid-state method from the bruker dynamics center using the correction for dipolar truncation with pdb 2nuz
PDB DOI: 10.2210/pdb8chg/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Caldanaerobius
Deposited: 2023-02-08 Deposition Author(s): Soeldner, B.
Sh3 domain solved by the exact solid-state method from the bruker dynamics center using the correction for dipolar truncation with pdb 2nuz
Primary Citation of Related Structures: 8CHG
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Spectrin alpha chain, non-erythrocytic 1 | A | 62 | Caldanaerobius | MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD |
Method: SOLID-STATE NMR
Deposited Date: 2023-02-08 Deposition Author(s): Soeldner, B.