Crystal structure of scribble pdz1 with pthr
PDB DOI: 10.2210/pdb8bia/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2022-11-02 Deposition Author(s): Kvansakul, M. , Stewart, B.Z.
Crystal structure of scribble pdz1 with pthr
Primary Citation of Related Structures: 8BIA
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protein scribble homolog | A | 116 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | APSVKGVSFDQANNLLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERM |
Parathyroid hormone/parathyroid hormone-related peptide receptor | C | 8 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QEEWETVM |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-11-02 Deposition Author(s): Kvansakul, M. , Stewart, B.Z.