Advanced Search:
8BG9
Murine amyloid-beta filaments with the arctic mutation (e22g) from app(nl-g-f) mouse brains | abeta
PDB DOI: 10.2210/pdb8bg9/pdb
Classification: PROTEIN FIBRIL Organism(s): Mus Musculus
Deposited: 2022-10-27 Deposition Author(s): Ghetti, B. , Goedert, M. , Graff, C. , Huang, M. , Kumar, A. , Lavenir, I. , Lovestam, S.K.A. , Macdonald, J. , Murzin, A.G. , Nordber, A. , Peak-Chew, S.Y. , Scheres, S.H.W. , Schweighauser, M. , Yang, Y. , Zhang, W.J.
Experimental Data Snapshot
Method: ELECTRON MICROSCOPY Resolution: 3.5 Å
Murine amyloid-beta filaments with the arctic mutation (e22g) from app(nl-g-f) mouse brains | abeta
Ghetti, B. , Goedert, M. , Graff, C. , Huang, M. , Kumar, A. , Lavenir, I. , Lovestam, S.K.A. , Macdonald, J. , Murzin, A.G. , Nordber, A. , Peak-Chew, S.Y. , Scheres, S.H.W. , Schweighauser, M. , Yang, Y. , Zhang, W.J.
Primary Citation of Related Structures: 8BG9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Amyloid-beta protein 40 | A | 37 | Mus Musculus | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG |
| Amyloid-beta protein 40 | B | 37 | Mus Musculus | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG |
Experimental Data
Method: ELECTRON MICROSCOPY
Deposited Date: 2022-10-27 Deposition Author(s): Ghetti, B. , Goedert, M. , Graff, C. , Huang, M. , Kumar, A. , Lavenir, I. , Lovestam, S.K.A. , Macdonald, J. , Murzin, A.G. , Nordber, A. , Peak-Chew, S.Y. , Scheres, S.H.W. , Schweighauser, M. , Yang, Y. , Zhang, W.J.