PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

8B87

Crystal structure of scribble pdz1 with human papillomavirus strain 16 e6 peptide

PDB DOI: 10.2210/pdb8b87/pdb

Classification: PROTEIN BINDING
Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2022-10-04
Deposition Author(s): Kvansakul, M. , Stewart, B.Z.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 2 Å

8b87
Literature

Crystal structure of scribble pdz1 with human papillomavirus strain 16 e6 peptide

Kvansakul, M. , Stewart, B.Z.

Primary Citation of Related Structures: 8B87


Proteins
Molecule Chains Sequence Length Organism Sequence
Protein scribble homolog A 120 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GPLGSAPSVKGVSFDQANNLLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRER
Protein scribble homolog B 120 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GPLGSAPSVKGVSFDQANNLLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRER
Protein E6 C 10 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) SSRTRRETQL
Protein E6 D 10 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) SSRTRRETQL
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2022-10-04
Deposition Author(s): Kvansakul, M. , Stewart, B.Z.