8B2F
Sh3-like cell wall binding domain of the gh24 family muramidase from trichophaea saccata in complex with triglycine
PDB DOI: 10.2210/pdb8b2f/pdb
Classification: HYDROLASE Organism(s): Trichophaea Saccata , Synthetic Construct
Deposited: 2022-09-13 Deposition Author(s): Blagova, E. , Cohn, M.T. , Davies, G.J. , Kiemer, L. , Klausen, M. , Lebedev, A.A. , Ming, L. , Moroz, O.V. , Nymand-Grarup, S. , Pache, R.A. , Schmidt, E.G.W. , Schnorr, K.M. , Skov, L.K. , Wilson, K.S. , Ye, L.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.183 Å
Sh3-like cell wall binding domain of the gh24 family muramidase from trichophaea saccata in complex with triglycine
Blagova, E. , Cohn, M.T. , Davies, G.J. , Kiemer, L. , Klausen, M. , Lebedev, A.A. , Ming, L. , Moroz, O.V. , Nymand-Grarup, S. , Pache, R.A. , Schmidt, E.G.W. , Schnorr, K.M. , Skov, L.K. , Wilson, K.S. , Ye, L.
Primary Citation of Related Structures: 8B2F
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SH3-like cell wall binding domain-containing protein | A | 74 | Trichophaea Saccata , Synthetic Construct | YPVKTDLHCRSSPSTSASIVRTYSSGTEVQIQCQTTGTSVQGSNVWDKTQHGCYVADYYVKTGHSGIFTTKCGS |
| SH3-like cell wall binding domain-containing protein | B | 74 | Trichophaea Saccata , Synthetic Construct | YPVKTDLHCRSSPSTSASIVRTYSSGTEVQIQCQTTGTSVQGSNVWDKTQHGCYVADYYVKTGHSGIFTTKCGS |
| GLY-GLY-GLY | H | 3 | Trichophaea Saccata , Synthetic Construct | GGG |
| GLY-GLY-GLY | T | 3 | Trichophaea Saccata , Synthetic Construct | GGG |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2022-09-13 Deposition Author(s): Blagova, E. , Cohn, M.T. , Davies, G.J. , Kiemer, L. , Klausen, M. , Lebedev, A.A. , Ming, L. , Moroz, O.V. , Nymand-Grarup, S. , Pache, R.A. , Schmidt, E.G.W. , Schnorr, K.M. , Skov, L.K. , Wilson, K.S. , Ye, L.