Crystal structure of the c-terminal domain of trypanosoma brucei cfap410
PDB DOI: 10.2210/pdb8axo/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Trypanosoma Brucei Brucei Treu927
Deposited: 2022-08-31 Deposition Author(s): Dong, G. , Stadler, A.
Crystal structure of the c-terminal domain of trypanosoma brucei cfap410
Primary Citation of Related Structures: 8AXO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
TbCFAP410-CTD | A | 36 | Trypanosoma Brucei Brucei Treu927 | QIGPTETGVVQAVKVLLSELSVEGLDEVRRFIDALQ |
TbCFAP410-CTD | B | 36 | Trypanosoma Brucei Brucei Treu927 | QIGPTETGVVQAVKVLLSELSVEGLDEVRRFIDALQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-08-31 Deposition Author(s): Dong, G. , Stadler, A.