8AXO
Crystal structure of the c-terminal domain of trypanosoma brucei cfap410
PDB DOI: 10.2210/pdb8axo/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Human Immunodeficiency Virus Type 1 (Hxb2 Isolate)
Deposited: 2022-08-31 Deposition Author(s): Dong, G. , Stadler, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.29 Å
Crystal structure of the c-terminal domain of trypanosoma brucei cfap410
Primary Citation of Related Structures: 8AXO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| TbCFAP410-CTD | A | 36 | Human Immunodeficiency Virus Type 1 (Hxb2 Isolate) | QIGPTETGVVQAVKVLLSELSVEGLDEVRRFIDALQ |
| TbCFAP410-CTD | B | 36 | Human Immunodeficiency Virus Type 1 (Hxb2 Isolate) | QIGPTETGVVQAVKVLLSELSVEGLDEVRRFIDALQ |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2022-08-31 Deposition Author(s): Dong, G. , Stadler, A.