PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

8AOO

Fucosylated mixed-chirality linear peptide fhp31 bound to the fucose binding lectin lecb pa-iil from pseudomonas aeruginosa at 1.2 angstrom resolution.

PDB DOI: 10.2210/pdb8aoo/pdb

Classification: ANTIBIOTIC
Organism(s): Platyrrhini , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2022-08-08
Deposition Author(s): Personne, H. , Reymond, J.-L. , Stocker, A.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.18 Å

8aoo
Literature

Fucosylated mixed-chirality linear peptide fhp31 bound to the fucose binding lectin lecb pa-iil from pseudomonas aeruginosa at 1.2 angstrom resolution.

Personne, H. , Reymond, J.-L. , Stocker, A.

Primary Citation of Related Structures: 8AOO


Proteins
Molecule Chains Sequence Length Organism Sequence
Fucose-binding lectin PA-IIL A 114 Platyrrhini , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Fucose-binding lectin PA-IIL B 114 Platyrrhini , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Fucose-binding lectin PA-IIL C 114 Platyrrhini , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Fucose-binding lectin PA-IIL D 114 Platyrrhini , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Fucosylated mixed-chirality peptide FHP31 E 12 Platyrrhini , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) KKLLKLLKLLLX
Fucosylated mixed-chirality peptide FHP31 F 12 Platyrrhini , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) KKLLKLLKLLLX
Fucosylated mixed-chirality peptide FHP31 H 12 Platyrrhini , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) KKLLKLLKLLLX
Fucosylated mixed-chirality peptide FHP31 I 12 Platyrrhini , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) KKLLKLLKLLLX
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2022-08-08
Deposition Author(s): Personne, H. , Reymond, J.-L. , Stocker, A.