8AN9
Fucosylated mixed-chirality linear peptide fhp5 bound to the fucose binding lectin lecb pa-iil from pseudomonas aeruginosa at 1.3 angstrom resolution.
PDB DOI: 10.2210/pdb8an9/pdb
Classification: ANTIBIOTIC Organism(s): Platyrrhini , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2022-08-04 Deposition Author(s): Personne, H. , Reymond, J.-L. , Stocker, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.273 Å
Fucosylated mixed-chirality linear peptide fhp5 bound to the fucose binding lectin lecb pa-iil from pseudomonas aeruginosa at 1.3 angstrom resolution.
Personne, H. , Reymond, J.-L. , Stocker, A.
Primary Citation of Related Structures: 8AN9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Fucose-binding lectin PA-IIL | A | 114 | Platyrrhini , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG |
| Fucose-binding lectin PA-IIL | B | 114 | Platyrrhini , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG |
| Fucose-binding lectin PA-IIL | C | 114 | Platyrrhini , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG |
| Fucose-binding lectin PA-IIL | D | 114 | Platyrrhini , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG |
| Mixed-chirality peptide FHP5 | E | 12 | Platyrrhini , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KKLLKLLKLLLX |
| Mixed-chirality peptide FHP5 | F | 12 | Platyrrhini , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KKLLKLLKLLLX |
| Mixed-chirality peptide FHP5 | G | 12 | Platyrrhini , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KKLLKLLKLLLX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2022-08-04 Deposition Author(s): Personne, H. , Reymond, J.-L. , Stocker, A.