Nmr structure of holo-acp
PDB DOI: 10.2210/pdb8a7z/pdb
Classification: TRANSFERASE Organism(s): Streptomyces Virginiae
Deposited: 2022-06-21 Deposition Author(s): Chagot, B. , Collin, S. , Gruez, A. , Weissman, K.J.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of holo-acp
Chagot, B. , Collin, S. , Gruez, A. , Weissman, K.J.
Primary Citation of Related Structures: 8A7Z
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hybrid polyketide synthase-non ribosomal peptide synthetase | A | 85 | Streptomyces Virginiae | GPGSAGRQEEIAEEVARLLAGVLYLEPDRLDPEETFLTLGVDSILGVEFVAAVNAAYPVGVKATALYDHPTPAAFARHIAESLGA |
Method: SOLUTION NMR
Deposited Date: 2022-06-21 Deposition Author(s): Chagot, B. , Collin, S. , Gruez, A. , Weissman, K.J.