Crystal structure of human bcl6 btb domain in complex with compound 10
PDB DOI: 10.2210/pdb7zwq/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2022-05-19 Deposition Author(s): Le Bihan, Y.-V. , Rodrigues, M.J. , Van Montfort, R.L.M.
Crystal structure of human bcl6 btb domain in complex with compound 10
Le Bihan, Y.-V. , Rodrigues, M.J. , Van Montfort, R.L.M.
Primary Citation of Related Structures: 7ZWQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| B-cell lymphoma 6 protein | A | 144 | Homo Sapiens | GPGLDYKDDDDKENLYFQGADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASE |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-05-19 Deposition Author(s): Le Bihan, Y.-V. , Rodrigues, M.J. , Van Montfort, R.L.M.