Crystal structure of unlinked ns2b-ns3 protease from zika virus in complex with inhibitor mi-2162
PDB DOI: 10.2210/pdb7zwk/pdb
Classification: VIRAL PROTEIN Organism(s): Zika Virus , Synthetic Construct
Deposited: 2022-05-19 Deposition Author(s): Huber, S. , Steinmetzer, T.
Crystal structure of unlinked ns2b-ns3 protease from zika virus in complex with inhibitor mi-2162
Primary Citation of Related Structures: 7ZWK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Serine protease subunit NS2B | A | 53 | Zika Virus , Synthetic Construct | MTGKSVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMRE |
| Serine protease NS3 | B | 178 | Zika Virus , Synthetic Construct | GSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKREEETPVE |
| (1R,2R,3S,4R,6S)-4,6-diamino-2,3-dihydroxycyclohexyl 2,6-diamino-2,6-dideoxy-alpha-D-glucopyranoside | C | 7 | Zika Virus , Synthetic Construct | XGGGFKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-05-19 Deposition Author(s): Huber, S. , Steinmetzer, T.