Crystal structure of the zymogen form of the glutamic-class prolyl-endopeptidase neprosin at 2.05 a resolution in presence of the crystallophore lu-xo4.
PDB DOI: 10.2210/pdb7zu8/pdb
Classification: HYDROLASE Organism(s): Nepenthes Ventricosa X Nepenthes Alata
Deposited: 2022-05-11 Deposition Author(s): Del Amo-Maestro, L. , Eckhard, U. , Gomis-Ruth, F.X. , Guevara, T. , Mendes, S.R. , Rodriguez-Banqueri, A.
Crystal structure of the zymogen form of the glutamic-class prolyl-endopeptidase neprosin at 2.05 a resolution in presence of the crystallophore lu-xo4.
Del Amo-Maestro, L. , Eckhard, U. , Gomis-Ruth, F.X. , Guevara, T. , Mendes, S.R. , Rodriguez-Banqueri, A.
Primary Citation of Related Structures: 7ZU8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Glutamyl endopeptidase Neprosin | A | 389 | Nepenthes Ventricosa X Nepenthes Alata | METDTLLLWVLLLWVPGSTGDLMVRSIQARLANKPKGTIKTIKGDDGEVVDCVDIYKQPAFDHPLLKNHTLQMQPSSYASKVGEYNKLEQPWHKNGECPKGSIPIRRQVITGLPVVKKQFPNLKFAPPSANTNHQYAVIAYFYGNASLQGANATINIWEPNLKNPNGDFSLTQIWISAGSGSSLNTIEAGWQVYPGRTGDSQPRFFIYWTADGYTSTGCYDLTCPGFVQTNNYYAIGMALQPSVYGGQQYELNESIQRDPATGNWWLYLWGTVVGYWPASIYNSITNGADTVEWGGEIYDSSGTGGFHTTTQMGSGHFPTEGYGKASYVRDLQCVDTYGNVISPTANSFQGIAPAPNCYNYQFQQGSSELYLFYGGPGCQAIAHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-05-11 Deposition Author(s): Del Amo-Maestro, L. , Eckhard, U. , Gomis-Ruth, F.X. , Guevara, T. , Mendes, S.R. , Rodriguez-Banqueri, A.