7ZOK
Solution structure of gltj znr domain from myxococcus xanthus
PDB DOI: 10.2210/pdb7zok/pdb
Classification: CELL ADHESION Organism(s): Myxococcus Xanthus
Deposited: 2022-04-25 Deposition Author(s): Attia, B. , Bornet, O. , Castaing, J.P. , Elantak, L. , Espinosa, L. , Le Guenno, H. , Mignot, T. , My, L. , Nouailler, M. , Schmidt, V.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of gltj znr domain from myxococcus xanthus
Attia, B. , Bornet, O. , Castaing, J.P. , Elantak, L. , Espinosa, L. , Le Guenno, H. , Mignot, T. , My, L. , Nouailler, M. , Schmidt, V.
Primary Citation of Related Structures: 7ZOK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Adventurous gliding motility protein X | A | 51 | Myxococcus Xanthus | MARFVCDSCRAQYMISDDKIGPKGVKVRCKKCGHTITVRPAGALEHHHHHH |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2022-04-25 Deposition Author(s): Attia, B. , Bornet, O. , Castaing, J.P. , Elantak, L. , Espinosa, L. , Le Guenno, H. , Mignot, T. , My, L. , Nouailler, M. , Schmidt, V.