Crystal structure of human brachyury g177d variant in complex with csc027898502
PDB DOI: 10.2210/pdb7zk2/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2022-04-12 Deposition Author(s): Aitkenhead, H. , Bountra, C. , Burgess-Brown, N.A. , Gavard, A. , Gileadi, O. , Imprachim, N. , Newman, J.A. , Sherestha, L. , Von Delft, F.
Crystal structure of human brachyury g177d variant in complex with csc027898502
Aitkenhead, H. , Bountra, C. , Burgess-Brown, N.A. , Gavard, A. , Gileadi, O. , Imprachim, N. , Newman, J.A. , Sherestha, L. , Von Delft, F.
Primary Citation of Related Structures: 7ZK2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| T-box transcription factor T | A | 172 | Homo Sapiens | GELRVGLEESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGDPQRMITSHCFPETQFIAVTAYQNEEITALKIKYN |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-04-12 Deposition Author(s): Aitkenhead, H. , Bountra, C. , Burgess-Brown, N.A. , Gavard, A. , Gileadi, O. , Imprachim, N. , Newman, J.A. , Sherestha, L. , Von Delft, F.