7ZEX
Complex cyp33-rrmdelta alpha : uaaugucg rna
PDB DOI: 10.2210/pdb7zex/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2022-03-31 Deposition Author(s): Allain, F. , Blatter, M. , Meylan, C.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Complex cyp33-rrmdelta alpha : uaaugucg rna
Allain, F. , Blatter, M. , Meylan, C.
Primary Citation of Related Structures: 7ZEX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Isoform 3 of Peptidyl-prolyl cis-trans isomerase E | A | 93 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AGHMATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEG |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RNA (5'-R(*UP*AP*AP*UP*GP*UP*CP*G)-3') | b | 8 | NA | UAAUGUCG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2022-03-31 Deposition Author(s): Allain, F. , Blatter, M. , Meylan, C.