Crystal structure of trim33 phd-bromodomain isoform b in complex with h3k10ac histone peptide.
PDB DOI: 10.2210/pdb7zdd/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2022-03-29 Deposition Author(s): Barker, J.J. , Caria, S. , Crespillo, S. , Duclos, S. , Errey, J.
Crystal structure of trim33 phd-bromodomain isoform b in complex with h3k10ac histone peptide.
Barker, J.J. , Caria, S. , Crespillo, S. , Duclos, S. , Errey, J.
Primary Citation of Related Structures: 7ZDD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase TRIM33 | A | 194 | Homo Sapiens , Synthetic Construct | SMDDDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLP |
| Histone H3.X | D | 10 | Homo Sapiens , Synthetic Construct | ARTKQTARKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-03-29 Deposition Author(s): Barker, J.J. , Caria, S. , Crespillo, S. , Duclos, S. , Errey, J.