7Z5L
Crystal structure of human insulin, crystallised in the presence of macrophage migration inhibitory factor (mif) and dimethyl sulfoxide (dmso)
PDB DOI: 10.2210/pdb7z5l/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2022-03-09 Deposition Author(s): Crennell, C. , Van Den Elsen, J.M.H. , Wahid, A.A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.4 Å
Crystal structure of human insulin, crystallised in the presence of macrophage migration inhibitory factor (mif) and dimethyl sulfoxide (dmso)
Crennell, C. , Van Den Elsen, J.M.H. , Wahid, A.A.
Primary Citation of Related Structures: 7Z5L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin A chain | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin B chain | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2022-03-09 Deposition Author(s): Crennell, C. , Van Den Elsen, J.M.H. , Wahid, A.A.